PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF049800070CFD_t1
Common NameTRAES_3BF049800070CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 982aa    MW: 107888 Da    PI: 5.1211
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF049800070CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-195096148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  TRAES3BF049800070CFD_t1 50 KGNWTPEEDDILSRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                             79******************************.************986 PP

2Myb_DNA-binding61.22.2e-19102148148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+W++eEd+++v+ vk++G++ W+tIa+ ++ gR +kqc++rw+++l
  TRAES3BF049800070CFD_t1 102 KGPWSKEEDDIIVEMVKKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                              79******************************.*************97 PP

3Myb_DNA-binding49.11.3e-15154196145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +++WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  TRAES3BF049800070CFD_t1 154 KDAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 196
                              679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4374596IPR017930Myb domain
SuperFamilySSF466894.74E-1948110IPR009057Homeodomain-like
SMARTSM007173.0E-174998IPR001005SANT/Myb domain
PfamPF002498.9E-175096IPR001005SANT/Myb domain
CDDcd001678.88E-155296No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2452113IPR009057Homeodomain-like
PROSITE profilePS5129432.21597152IPR017930Myb domain
SuperFamilySSF466892.81E-3199195IPR009057Homeodomain-like
SMARTSM007171.2E-18101150IPR001005SANT/Myb domain
CDDcd001674.66E-16104148No hitNo description
PfamPF139213.8E-18105165No hitNo description
Gene3DG3DSA:1.10.10.601.5E-26114155IPR009057Homeodomain-like
SMARTSM007171.9E-14153201IPR001005SANT/Myb domain
PROSITE profilePS5129419.934153203IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-21156203IPR009057Homeodomain-like
CDDcd001674.08E-11156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 982 aa     Download sequence    Send to blast
MTSDKGKASK KAGEASGQPS TTHEGKVSNE PQRQRSLNGR TTGPTRRSTK GNWTPEEDDI  60
LSRAVQTYNG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL IKGPWSKEED DIIVEMVKKY  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP GINKDAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNS IKNHWNSSVK KKIDSYMSSG LLAQVSRLPL IEHHAHFNSS PAITQQNSED  240
SDSNAVREVE DSSGCSQSSL AMVSCSQVQD TNLALSCDLH VNADTSKTEA RDSQSSMCQE  300
DYTSTEGAAS ALSEVHCHAS SSRFGPDKLL QQDISQRMNL QMDIDEIPGN SMFENNQTIC  360
STLNNERPML QYEIAPDMPI SVLTNVSGAE QKLHFMSEAD FSSPNCLKSE LWQEISFQSL  420
LSGPDIVDAD SLSRLNHHSD THSSEADTNF LAAPNPSHTS NPSSMMVAAY GQDPSLSVPQ  480
SLISNGLSDA ADEKSGEMQV SGSEMITCMH DSFGDSEQFA TPGSTDGRHG ASAIIERIPE  540
YGDKQLTDAE EPAASMAKEP PLAQGEAASD EKQDKGALFY EPPRFPSMDV PFVSCDLVTS  600
GDLQEYSPLG IRQLMRSTMS VTTPLRLWGS PTHDESPDVV LKSAAKSFIS TPSILKKRPR  660
DLSSPTPEKR MERKSRTEQD SGVLGTSSVS AQTSCMHAIK DKAIVTESVL CTNRSSSFKP  720
LEKKLEFCDE NKEILGESEQ AKDGRNAQNN HTVDEHARGE QCSTANMVNT NDEPPATVLV  780
EHKDNDISDH GANAMYQKMN TNLEALSACK EAFAKSKSGE LIAEKSSPCI QMDYEYVNIL  840
ADTPGVKRGL ESPSAWKSPW FIDMQYKGSY FISPADTTYD ALGLMKRINV QSASALADAR  900
EVLASGSQCG NKIFDEENKE NIDAENETGT GKPQNKIMAE ARVLDFNECA TPVRTADNSV  960
GGSLTKSVSS PIPSSHLLKN FR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-67502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-67502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753766.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
SwissprotQ9S7G71e-105MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A077RQZ80.0A0A077RQZ8_WHEAT; Uncharacterized protein
STRINGMLOC_10556.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-106Homeodomain-like protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]